Search results for "Super Proton Synchrotron"

showing 6 items of 6 documents

Lead evaporation instabilities and failure mechanisms of the micro oven at the GTS-LHC ECR ion source at CERN

2020

The GTS-LHC ECR ion source (named after the Grenoble Test Source and the Large Hadron Collider) at CERN provides heavy ion beams for the chain of accelerators from Linac3 up to the LHC for high energy collision experiments and to the Super Proton Synchrotron for fixed target experiments. During the standard operation, the oven technique is used to evaporate lead into the source plasma to produce multiple charged lead ion beams. Intensity and stability are key parameters for the beam, and the operational experience is that some of the source instabilities can be linked to the oven performance. Over long operation periods of several weeks, the evaporation is not stable which makes the tuning …

010302 applied physicsRange (particle radiation)Large Hadron ColliderMaterials scienceionitNuclear engineeringEvaporationPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesSuper Proton SynchrotronIon source010305 fluids & plasmasIonComputer Science::OtherPhysics::Popular Physics0103 physical scienceslyijyInstrumentationBeam (structure)
researchProduct

Study of the response of the ATLAS central calorimeter to pions of energies from 3 to 9 GeV

2009

Çetin, Serkant Ali (Dogus Author) A fully instrumented slice of the ATLAS central detector was exposed to test beams from the SPS (Super Proton Synchrotron) at CERN in 2004. In this paper, the response of the central calorimeters to pions with energies in the range between 3 and 9 GeV is presented. The linearity and the resolution of the combined calorimetry (electromagnetic and hadronic calorimeters) was measured and compared to the prediction of a detector simulation program using the toolkit Geant 4.

Nuclear and High Energy PhysicsParticle physicsPhysics::Instrumentation and DetectorsHadronNuclear TheoryCalorimetry01 natural sciencesNuclear physicsPionAtlas (anatomy)0103 physical sciencesmedicineCalibration[PHYS.PHYS.PHYS-INS-DET]Physics [physics]/Physics [physics]/Instrumentation and Detectors [physics.ins-det]010306 general physicsNuclear ExperimentInstrumentationPhysicsLarge Hadron Collider010308 nuclear & particles physicsDetectorATLASSuper Proton SynchrotronCalorimetermedicine.anatomical_structureCalibrationPhysics::Accelerator PhysicsHigh Energy Physics::ExperimentTest beamSimulation
researchProduct

Study of energy response and resolution of the ATLAS barrel calorimeter to hadrons of energies from 20 to 350 GeV

2010

A fully instrumented slice of the ATLAS detector was exposed to test beams from the SPS (Super Proton Synchrotron) at CERN in 2004. In this paper, the results of the measurements of the response of the barrel calorimeter to hadrons with energies in the range 20 to 350 GeV and beam impact points and angles corresponding to pseudorapidity values in the range 0.2-0.65 are reported. The results are compared to the predictions of a simulation program using the Geant 4 toolkit.

Nuclear and High Energy PhysicsParticle physicsPhysics::Instrumentation and DetectorsTest-beamHadronCalorimetry01 natural sciencesNuclear physicsAtlas (anatomy)0103 physical sciencesmedicine[PHYS.HEXP]Physics [physics]/High Energy Physics - Experiment [hep-ex][PHYS.PHYS.PHYS-INS-DET]Physics [physics]/Physics [physics]/Instrumentation and Detectors [physics.ins-det]010306 general physicsNuclear ExperimentInstrumentationPhysicsRange (particle radiation)Large Hadron ColliderCalorimeter (particle physics)010308 nuclear & particles physicsATLASSuper Proton Synchrotronmedicine.anatomical_structurePseudorapidityCalibrationPhysics::Accelerator PhysicsHigh Energy Physics::ExperimentBeam (structure)Simulation
researchProduct

Nuclear Modification ofψ′,χc, andJ/ψProduction ind+AuCollisions atsNN=200  GeV

2013

We present results for three charmonia states (psi' chi(c), and J/ psi) in d + Au collisions at vertical bar y vertical bar < 0.35 and root s(NN) = 200 GeV. We find that the modification of the psi' yield relative to that of the J/ psi scales approximately with charged particle multiplicity at midrapidity across p + A, d + Au, and A + A results from the Super Proton Synchrotron and the Relativistic Heavy Ion Collider. In large-impact-parameter collisions we observe a similar suppression for the psi' and J/ psi, while in small-impact-parameter collisions the more weakly bound psi' is more strongly suppressed. Owing to the short time spent traversing the Au nucleus, the larger psi' suppressio…

PhysicsMeson010308 nuclear & particles physicsGeneral Physics and Astronomy01 natural sciences7. Clean energySuper Proton SynchrotronCharged particleNuclear physicsDeuterium0103 physical sciencesYield ratioHigh Energy Physics::ExperimentMultiplicity (chemistry)Atomic physicsNuclear Experiment010306 general physicsRelativistic Heavy Ion ColliderPhysical Review Letters
researchProduct

Search for a neutral Higgs particle in the decay sequence $K^{0}_{L} \to \pi^{0}H^{0}$ and $H^{0} \to e^{+}e^{-}$

1990

Abstract We have searched for the sequence of decays K L 0 → π 0 H 0 and H 0 →e + e − at the CERN Super Proton Synchrotron (SPS), and have allowed for a non-zero H 0 lifetime. Three candidates have been seen, consistent with an expected background of 3.3. Limits on the branching ratio product in the range 10 −8 –10 −7 are presented as a function of the mass and lifetime of the H 0 . These can be used to restrict the neutral Higgs of the minimal standard model.

PhysicsNuclear and High Energy PhysicsSequenceParticle physicsRange (particle radiation)Large Hadron ColliderBranching fractionElementary particleSuper Proton SynchrotronStandard ModelNuclear physicsHiggs bosonHigh Energy Physics::ExperimentParticle Physics - Experiment
researchProduct

Dielectron production in Au + Au collisions atsNN=200GeV

2016

We present measurements of e+e- production at midrapidity in Au+Au collisions at sNN=200 GeV. The invariant yield is studied within the PHENIX detector acceptance over a wide range of mass (mee<5 GeV/c2) and pair transverse momentum (pT<5 GeV/c) for minimum bias and for five centrality classes. The e+e- yield is compared to the expectations from known sources. In the low-mass region (mee=0.30-0.76 GeV/c2) there is an enhancement that increases with centrality and is distributed over the entire pair pT range measured. It is significantly smaller than previously reported by the PHENIX experiment and amounts to 2.3±0.4(stat)±0.4(syst)±0.2(model) or to 1.7±0.3(stat)±0.3(syst)±0.2(model) for min…

PhysicsParticle physicsMeson010308 nuclear & particles physicsDalitz plot01 natural sciencesSuper Proton SynchrotronParticle identificationNuclear physicsPair production0103 physical sciencesHigh Energy Physics::ExperimentRapidityPHENIX detectorNuclear Experiment010306 general physicsGlauberPhysical Review C
researchProduct